PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.E01420.1.p
Common NameLOC105967267, LOC105967268, MIMGU_mgv1a010821mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family Trihelix
Protein Properties Length: 301aa    MW: 33755.7 Da    PI: 4.5415
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.E01420.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix31.64.3e-101987270
          trihelix  2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekk 70
                      Wt +e l L++    +e++ +++    ++W+++ +++ +  ++r+ +qCk kw++l  +y+++k+ +  
  Migut.E01420.1.p 19 WTAEESLILVNEIYAVESEWGATLPSFQKWQQIVENCNALEVSRNLNQCKRKWDELLIEYRRVKHDAAA 87
                      ****************************************************************98775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138378.3E-1018100No hitNo description
PROSITE profilePS500907.1781975IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MDEPRGSRRC TRSRAAPDWT AEESLILVNE IYAVESEWGA TLPSFQKWQQ IVENCNALEV  60
SRNLNQCKRK WDELLIEYRR VKHDAAADGS LPVELFDAID MCVGARGRKY GGAEAAAVAA  120
EKAVAEEEEQ VVMATDPDSD PEAQGRATEF FLETGTKKQR PRMKRKKRRL ETLNPWGYST  180
SAKSIKQEEE EENSNINEKR GNTNNVTQST PEPEQSSVET REQIMATMLW DNAMKINAIL  240
EGNVADDTDY KLADMKNAEA VETDFTRLQG DKLIDCFGKI SETLKQLCEI VQQNATAALP  300
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1156169KKQRPRMKRKKRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012847324.10.0PREDICTED: uncharacterized protein LOC105967267
RefseqXP_012847325.10.0PREDICTED: uncharacterized protein LOC105967268
TrEMBLA0A022QKB50.0A0A022QKB5_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA83602124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.13e-32sequence-specific DNA binding transcription factors